Lineage for d3wa0a1 (3wa0 A:24-103)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1638517Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1638518Protein automated matches [190233] (10 species)
    not a true protein
  7. 1638593Species Mouse (Mus musculus) [TaxId:10090] [189205] (5 PDB entries)
  8. 1638596Domain d3wa0a1: 3wa0 A:24-103 [256457]
    Other proteins in same PDB: d3wa0a2, d3wa0a3
    automated match to d1h4ra3

Details for d3wa0a1

PDB Entry: 3wa0 (more details), 2.31 Å

PDB Description: Crystal structure of merlin complexed with DCAF1/VprBP
PDB Compounds: (A:) merlin

SCOPe Domain Sequences for d3wa0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wa0a1 d.15.1.0 (A:24-103) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdkkvld
hdvskeepvtfhflakfype

SCOPe Domain Coordinates for d3wa0a1:

Click to download the PDB-style file with coordinates for d3wa0a1.
(The format of our PDB-style files is described here.)

Timeline for d3wa0a1: