Lineage for d2moua_ (2mou A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2215232Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2215233Protein automated matches [190218] (22 species)
    not a true protein
  7. 2215340Species Human (Homo sapiens) [TaxId:9606] [255576] (2 PDB entries)
  8. 2215343Domain d2moua_: 2mou A: [256450]
    automated match to d2r55a_

Details for d2moua_

PDB Entry: 2mou (more details)

PDB Description: Solution structure of StAR-related lipid transfer domain protein 6 (STARD6)
PDB Compounds: (A:) StAR-related lipid transfer protein 6

SCOPe Domain Sequences for d2moua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2moua_ d.129.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdfkaiaqqtaqevlgynrdtsgwkvvktskkitvsskasrkfhgnlyrvegiipespak
lsdflyqtgdritwdkslqvynmvhridsdtfichtitqsfavgsisprdfidlvyikry
egnmniissksvdfpeyppssnyirgynhpcgfvcspmeenpaysklvmfvqtemrgkls
psiiektmpsnlvnfilnakdgikahrtpsrrgfhhnshs

SCOPe Domain Coordinates for d2moua_:

Click to download the PDB-style file with coordinates for d2moua_.
(The format of our PDB-style files is described here.)

Timeline for d2moua_: