SCOP 1.61: Domain d1gaqa1: 1gaq A:19-156

Lineage for d1gaqa1 (1gaq A:19-156)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Maize (Zea mays), leaf isoform [TaxId:4577] [50419] (2 PDB entries)

8. Domain d1gaqa1: 1gaq A:19-156 [25645]
   Other proteins in same PDB: d1gaqa2, d1gaqb_, d1gaqc2

Details for d1gaqa1

PDB Entry: 1gaq, 2.59 Å

PDB Description: crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase

SCOP Domain Sequences for d1gaqa1:

Sequence; same for both SEQRES and ATOM records:

>d1gaqa1 b.43.4.2 (A:19-156) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), leaf isoform}
eskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipyregqsigv
iadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkgvcsnflcd
lqpgdnvqitgpvgkeml

Timeline for d1gaqa1:

• d1gaqa1 first appeared (with stable ids) in SCOP 1.55
  
• d1gaqa1 appears in SCOP 1.59
  
• d1gaqa1 appears in SCOP 1.63
  
• d1gaqa1 appears in the current release, SCOPe 2.08