SCOPe 2.08: Domain d2mnga1: 2mng A:579-707

Lineage for d2mnga1 (2mng A:579-707)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189505] (8 PDB entries)

8. Domain d2mnga1: 2mng A:579-707 [256448]
   Other proteins in same PDB: d2mnga2
   automated match to d3cl1a_

Details for d2mnga1

PDB Entry: 2mng

PDB Description: Apo Structure of human HCN4 CNBD solved by NMR

PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4

SCOPe Domain Sequences for d2mnga1:

Sequence; same for both SEQRES and ATOM records:

>d2mnga1 b.82.3.2 (A:579-707) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhg
vvsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypm
mrrafetva

Timeline for d2mnga1:

• d2mnga1 first appeared in SCOPe 2.04, called d2mnga_
  
• d2mnga1 appears in SCOPe 2.07