Lineage for d1gawa1 (1gaw A:11-156)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60149Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 60166Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)
  6. 60175Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 60199Species Maize (Zea mays), leaf isoform [TaxId:4577] [50419] (2 PDB entries)
  8. 60200Domain d1gawa1: 1gaw A:11-156 [25643]
    Other proteins in same PDB: d1gawa2, d1gawb2

Details for d1gawa1

PDB Entry: 1gaw (more details), 2.2 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from maize leaf

SCOP Domain Sequences for d1gawa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gawa1 b.43.4.2 (A:11-156) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), leaf isoform}
patakakkeskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipy
regqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkg
vcsnflcdlqpgdnvqitgpvgkeml

SCOP Domain Coordinates for d1gawa1:

Click to download the PDB-style file with coordinates for d1gawa1.
(The format of our PDB-style files is described here.)

Timeline for d1gawa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gawa2