Lineage for d2m8sa_ (2m8s A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1637453Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1637466Protein Bag-family molecular chaperone regulator-1 [142932] (2 species)
  7. 1637469Species Mouse (Mus musculus) [TaxId:10090] [255463] (2 PDB entries)
  8. 1637471Domain d2m8sa_: 2m8s A: [256414]
    automated match to d2lwpa_

Details for d2m8sa_

PDB Entry: 2m8s (more details)

PDB Description: NMR Structure of the Cytoplasmic Tail of the Membrane Form of Heparin-binding EGF-like Growth Factor (proHB-EGF-CT) Complexed with the Ubiquitin Homology Domain of Bcl-2-associated Athanogene 1 from Mus musculus (mBAG-1-UBH)
PDB Compounds: (A:) BAG family molecular chaperone regulator 1

SCOPe Domain Sequences for d2m8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m8sa_ d.15.1.1 (A:) Bag-family molecular chaperone regulator-1 {Mouse (Mus musculus) [TaxId: 10090]}
makteemvqteemetprlsvivthsnerydllvtpqqgnsepvvqdlaqlveeatgvplp
fqklifkgkslkemetplsalgmqngcrvmligeksn

SCOPe Domain Coordinates for d2m8sa_:

Click to download the PDB-style file with coordinates for d2m8sa_.
(The format of our PDB-style files is described here.)

Timeline for d2m8sa_: