Lineage for d1qfya1 (1qfy A:1-153)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111309Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 111386Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 111406Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)
  6. 111418Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 111437Species Garden pea (Pisum sativum) [TaxId:3888] [50417] (4 PDB entries)
  8. 111440Domain d1qfya1: 1qfy A:1-153 [25635]
    Other proteins in same PDB: d1qfya2, d1qfyb2

Details for d1qfya1

PDB Entry: 1qfy (more details), 1.8 Å

PDB Description: pea fnr y308s mutant in complex with nadp+

SCOP Domain Sequences for d1qfya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfya1 b.43.4.2 (A:1-153) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Garden pea (Pisum sativum)}
qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg
evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage
vvkgvcsnflcdlkpgsevkitgpvgkemlmpk

SCOP Domain Coordinates for d1qfya1:

Click to download the PDB-style file with coordinates for d1qfya1.
(The format of our PDB-style files is described here.)

Timeline for d1qfya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qfya2