SCOP 1.61: Domain d1qfzb1: 1qfz B:514-653

Lineage for d1qfzb1 (1qfz B:514-653)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [50417] (4 PDB entries)

8. Domain d1qfzb1: 1qfz B:514-653 [25634]
   Other proteins in same PDB: d1qfza2, d1qfzb2

Details for d1qfzb1

PDB Entry: 1qfz, 1.7 Å

PDB Description: pea fnr y308s mutant in complex with nadph

SCOP Domain Sequences for d1qfzb1:

Sequence; same for both SEQRES and ATOM records:

>d1qfzb1 b.43.4.2 (B:514-653) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Garden pea (Pisum sativum)}
skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv
pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcdl
kpgsevkitgpvgkemlmpk

Timeline for d1qfzb1:

• d1qfzb1 first appeared (with stable ids) in SCOP 1.55
  
• d1qfzb1 appears in SCOP 1.59
  
• d1qfzb1 appears in SCOP 1.63
  
• d1qfzb1 appears in the current release, SCOPe 2.08