Lineage for d1qfza1 (1qfz A:1-153)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544418Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 1544455Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 1544481Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)
  7. 1544517Species Pea (Pisum sativum) [TaxId:3888] [50417] (4 PDB entries)
  8. 1544518Domain d1qfza1: 1qfz A:1-153 [25633]
    Other proteins in same PDB: d1qfza2, d1qfzb2
    complexed with fad, ndp, so4; mutant

Details for d1qfza1

PDB Entry: 1qfz (more details), 1.7 Å

PDB Description: pea fnr y308s mutant in complex with nadph
PDB Compounds: (A:) protein (ferredoxin:nadp+ reductase)

SCOPe Domain Sequences for d1qfza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfza1 b.43.4.2 (A:1-153) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Pea (Pisum sativum) [TaxId: 3888]}
qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg
evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage
vvkgvcsnflcdlkpgsevkitgpvgkemlmpk

SCOPe Domain Coordinates for d1qfza1:

Click to download the PDB-style file with coordinates for d1qfza1.
(The format of our PDB-style files is described here.)

Timeline for d1qfza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qfza2