Lineage for d1frn_1 (1frn 19-154)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111309Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 111386Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 111406Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)
  6. 111418Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 111456Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)
  8. 111462Domain d1frn_1: 1frn 19-154 [25631]
    Other proteins in same PDB: d1frn_2

Details for d1frn_1

PDB Entry: 1frn (more details), 2 Å

PDB Description: the involvement of ser96 in the catalytic mechanism of ferredoxin-nadp+ reductase: structure-function relationship as studied by site-directed mutagenesis and x-ray crystallography

SCOP Domain Sequences for d1frn_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frn_1 b.43.4.2 (19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea)}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlyviassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

SCOP Domain Coordinates for d1frn_1:

Click to download the PDB-style file with coordinates for d1frn_1.
(The format of our PDB-style files is described here.)

Timeline for d1frn_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1frn_2