Lineage for d1bx1a1 (1bx1 A:19-154)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167557Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 167645Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 167665Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins)
  6. 167681Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 167720Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)
  8. 167724Domain d1bx1a1: 1bx1 A:19-154 [25629]
    Other proteins in same PDB: d1bx1a2

Details for d1bx1a1

PDB Entry: 1bx1 (more details), 1.9 Å

PDB Description: ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312q

SCOP Domain Sequences for d1bx1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx1a1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea)}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

SCOP Domain Coordinates for d1bx1a1:

Click to download the PDB-style file with coordinates for d1bx1a1.
(The format of our PDB-style files is described here.)

Timeline for d1bx1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bx1a2