Lineage for d1fnb_1 (1fnb 19-154)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies) 
Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families) 
Family b.43.1.1: Reductases [50414] (4 proteins) Protein Ferredoxin reductase (flavodoxin reductase) [50415] (7 species) 
Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries) 
Domain d1fnb_1: 1fnb 19-154 [25628]
Other proteins in same PDB: d1fnb_2
Details for d1fnb_1
PDB Entry: 1fnb (more details), 1.7 Å
PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states
SCOP Domain Sequences for d1fnb_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnb_1 b.43.1.1 (19-154) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke
SCOP Domain Coordinates for d1fnb_1:
Click to download the PDB-style file with coordinates for d1fnb_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fnb_1:
- d1fnb_1 appears in SCOP 1.57
- d1fnb_1 appears in the current release, SCOPe 2.08, called d1fnba1
View in 3D
