Lineage for d1epwa2 (1epw A:1080-1290)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543707Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 1543768Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 1543769Protein Botulinum neurotoxin [50402] (2 species)
  7. 1543778Species Clostridium botulinum, serotype B [TaxId:1491] [50404] (14 PDB entries)
  8. 1543779Domain d1epwa2: 1epw A:1080-1290 [25614]
    Other proteins in same PDB: d1epwa1, d1epwa3, d1epwa4
    complexed with so4, zn

Details for d1epwa2

PDB Entry: 1epw (more details), 1.9 Å

PDB Description: crystal structure of clostridium neurotoxin type b
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d1epwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epwa2 b.42.4.2 (A:1080-1290) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
seylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdly
igekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisd
sdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcis
kwylkevkrkpynlklgcnwqfipkdegwte

SCOPe Domain Coordinates for d1epwa2:

Click to download the PDB-style file with coordinates for d1epwa2.
(The format of our PDB-style files is described here.)

Timeline for d1epwa2: