Lineage for d3btaa2 (3bta A:1079-1295)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14541Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 14570Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
  6. 14571Protein Botulinum neurotoxin [50402] (2 species)
  7. 14572Species Clostridium botulinum, serotype A [TaxId:1491] [50403] (1 PDB entry)
  8. 14573Domain d3btaa2: 3bta A:1079-1295 [25613]
    Other proteins in same PDB: d3btaa1, d3btaa3, d3btaa4

Details for d3btaa2

PDB Entry: 3bta (more details), 3.2 Å

PDB Description: crystal structure of botulinum neurotoxin serotype a
PDB Compounds: (A:)

SCOP Domain Sequences for d3btaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btaa2 b.42.4.2 (A:1079-1295) Botulinum neurotoxin {Clostridium botulinum, serotype A}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaleipdvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnnia
klvasnwynrqierssrtlgcswefipvddgwgerpl

SCOP Domain Coordinates for d3btaa2:

Click to download the PDB-style file with coordinates for d3btaa2.
(The format of our PDB-style files is described here.)

Timeline for d3btaa2: