Lineage for d1d0ha2 (1d0h A:1111-1315)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) 
Superfamily b.42.4: STI-like [50386] (2 families) 
Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins) Protein Tetanus neurotoxin [50400] (1 species) Species Clostridium tetani [50401] (6 PDB entries) 
Domain d1d0ha2: 1d0h A:1111-1315 [25610]
Other proteins in same PDB: d1d0ha1
Details for d1d0ha2
PDB Entry: 1d0h (more details), 2.1 Å
PDB Description: the hc fragment of tetanus toxin complexed with n-acetyl-galactosamine
SCOP Domain Sequences for d1d0ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d0ha2 b.42.4.2 (A:1111-1315) Tetanus neurotoxin {Clostridium tetani}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd
SCOP Domain Coordinates for d1d0ha2:
Click to download the PDB-style file with coordinates for d1d0ha2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d0ha2:
- d1d0ha2 appears in SCOP 1.57
- d1d0ha2 appears in the current release, SCOPe 2.08
View in 3D
