Class b: All beta proteins [48724] (174 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins) |
Protein Soybean trypsin inhibitor [50394] (1 species) |
Species Soybean (Glycine max) [TaxId:3847] [50395] (4 PDB entries) |
Domain d1avwb_: 1avw B: [25599] Other proteins in same PDB: d1avwa_ complexed with ca |
PDB Entry: 1avw (more details), 1.75 Å
SCOPe Domain Sequences for d1avwb_:
Sequence, based on SEQRES records: (download)
>d1avwb_ b.42.4.1 (B:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]} dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkld
>d1avwb_ b.42.4.1 (B:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]} dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl ervsefnnyklvfcpqdkcgdigisidhddgtrrlvvsknkplvvqfqkld
Timeline for d1avwb_: