SCOPe 2.06: Domain d1wbca_: 1wbc A:

Lineage for d1wbca_ (1wbc A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
   automatically mapped to Pfam PF00197

6. Protein chymotrypsin inhibitor WCI [50392] (1 species)

7. Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (8 PDB entries)

8. Domain d1wbca_: 1wbc A: [25598]

Details for d1wbca_

PDB Entry: 1wbc, 2.95 Å

PDB Description: crystallization and preliminary x-ray studies of psophocarpin b1, a chymotrypsin inhibitor from winged bean seeds

PDB Compounds: (A:) chymotrypsin inhibitor (wci)

SCOPe Domain Sequences for d1wbca_:

Sequence; same for both SEQRES and ATOM records:

>d1wbca_ b.42.4.1 (A:) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkakseta
ssh

Timeline for d1wbca_:

• d1wbca_ first appeared (with stable ids) in SCOP 1.55, called d1wbc__
  
• d1wbca_ appears in SCOPe 2.05
  
• d1wbca_ appears in SCOPe 2.07
  
• d1wbca_ appears in the current release, SCOPe 2.08