Lineage for d2wbc__ (2wbc -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) 
Superfamily b.42.4: STI-like [50386] (2 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (5 proteins) 
Protein chymotrypsin inhibitor WCI [50392] (1 species) Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (6 PDB entries) 
Domain d2wbc__: 2wbc - [25597]
Details for d2wbc__
PDB Entry: 2wbc (more details), 2.3 Å
PDB Description: refined crystal structure (2.3 angstrom) of a winged bean chymotrypsin inhibitor and location of its second reactive site
SCOP Domain Sequences for d2wbc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wbc__ b.42.4.1 (-) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus)}
dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkakseta
ssh
SCOP Domain Coordinates for d2wbc__:
Click to download the PDB-style file with coordinates for d2wbc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wbc__:
- d2wbc__ first appeared (with stable ids) in SCOP 1.55
- d2wbc__ appears in SCOP 1.59
- d2wbc__ appears in the current release, SCOPe 2.08, called d2wbca_
View in 3D