Lineage for d4wbca_ (4wbc A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) 
Superfamily b.42.4: STI-like [50386] (2 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (5 proteins) 
Protein chymotrypsin inhibitor WCI [50392] (1 species) Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (6 PDB entries) 
Domain d4wbca_: 4wbc A: [25596]
Details for d4wbca_
PDB Entry: 4wbc (more details), 2.14 Å
PDB Description: 2.13 a structure of a kunitz-type winged bean chymotrypsin inhibitor protein
SCOP Domain Sequences for d4wbca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wbca_ b.42.4.1 (A:) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus)}
dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkakseta
SCOP Domain Coordinates for d4wbca_:
Click to download the PDB-style file with coordinates for d4wbca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4wbca_:
- d4wbca_ appears in SCOP 1.57
- d4wbca_ appears in the current release, SCOPe 2.08
View in 3D