Lineage for d1fmza_ (1fmz A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) 
Superfamily b.42.4: STI-like [50386] (2 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (5 proteins) 
Protein chymotrypsin inhibitor WCI [50392] (1 species) Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (6 PDB entries) 
Domain d1fmza_: 1fmz A: [25594]
Details for d1fmza_
PDB Entry: 1fmz (more details), 2.05 Å
PDB Description: crystal structure of a mutant winged bean chymotrypsin inhibitor protein, n14k.
SCOP Domain Sequences for d1fmza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fmza_ b.42.4.1 (A:) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus)}
efdddlvdaegnlvekggtyyllphiwahgggietaktgnepcpltvvrspnevskgepi
rissqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfk
fekvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks
SCOP Domain Coordinates for d1fmza_:
Click to download the PDB-style file with coordinates for d1fmza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fmza_:
- d1fmza_ appears in SCOP 1.57
- d1fmza_ appears in the current release, SCOPe 2.08, called d1fmza1
View in 3D