Lineage for d1fmza1 (1fmz A:4-180)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.4: STI-like [50386] (3 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
automatically mapped to Pfam PF00197
Protein chymotrypsin inhibitor WCI [50392] (1 species) Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (8 PDB entries) 
Domain d1fmza1: 1fmz A:4-180 [25594]
Other proteins in same PDB: d1fmza2
complexed with so4; mutant
Details for d1fmza1
PDB Entry: 1fmz (more details), 2.05 Å
PDB Description: crystal structure of a mutant winged bean chymotrypsin inhibitor protein, n14k.
PDB Compounds: (A:) Chymotrypsin inhibitor 3SCOPe Domain Sequences for d1fmza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fmza1 b.42.4.1 (A:4-180) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dddlvdaegnlvekggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks
SCOPe Domain Coordinates for d1fmza1:
Click to download the PDB-style file with coordinates for d1fmza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fmza1:
- d1fmza1 first appeared (with stable ids) in SCOP 1.55, called d1fmza_
- d1fmza1 appears in SCOPe 2.07
View in 3D
