Lineage for d1tie__ (1tie -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) 
Superfamily b.42.4: STI-like [50386] (2 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (5 proteins) 
Protein Erythrina cafra trypsin inhibitor [50390] (1 species) Species Erythrina caffra [TaxId:3842] [50391] (1 PDB entry) 
Domain d1tie__: 1tie - [25592]
Details for d1tie__
PDB Entry: 1tie (more details), 2.5 Å
PDB Description: crystal structure of a kunitz-type trypsin inhibitor from erythrina caffra seeds
SCOP Domain Sequences for d1tie__:
Sequence, based on SEQRES records: (download)
>d1tie__ b.42.4.1 (-) Erythrina cafra trypsin inhibitor {Erythrina caffra}
vlldgngevvqnggtyyllpqvwaqgggvqlaktgeetcpltvvqspnelsdgkpiries
rlrsafipdddkvrigfayapkcapspwwtvvedeqeglsvklsedestqfdypfkfeqv
sdqlhsykllycegkhekcasiginrdqkgyrrlvvtedypltvvlkkde
Sequence, based on observed residues (ATOM records): (download)
>d1tie__ b.42.4.1 (-) Erythrina cafra trypsin inhibitor {Erythrina caffra}
vlldgngevvqnggtyyllpqvwaqgggvqlaktgeetcpltvvqspnelsdgkpiries
rlrsafipdddkvrigfayapkcapspwwtvveglsvklsedestqfdypfkfeqvsdql
hsykllycegkhekcasiginrdqkgyrrlvvtedypltvvlkkde
SCOP Domain Coordinates for d1tie__:
Click to download the PDB-style file with coordinates for d1tie__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tie__:
- d1tie__ appears in SCOP 1.57
- d1tie__ appears in the current release, SCOPe 2.08, called d1tiea_
View in 3D