Lineage for d1wba__ (1wba -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) 
Superfamily b.42.4: STI-like [50386] (2 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (5 proteins) 
Protein Winged bean albumin 1 [50388] (1 species) Species Goa bean (Psophocarpus tetragonolobus) [TaxId:3891] [50389] (1 PDB entry) 
Domain d1wba__: 1wba - [25591]
Details for d1wba__
PDB Entry: 1wba (more details), 1.8 Å
PDB Description: winged bean albumin 1
SCOP Domain Sequences for d1wba__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wba__ b.42.4.1 (-) Winged bean albumin 1 {Goa bean (Psophocarpus tetragonolobus)}
ddpvydaegnklvnrgkytivsfsdgagidvvatgnenpedplsivkstrnimyatsiss
edktppqprnilenmrlkinfatdphkgdvwsvvdfqpdgqqlklagrypnqvkgaftiq
kgsntprtykllfcpvgspcknigistdpegkkrlvvsyqsdplvvkfhrh
SCOP Domain Coordinates for d1wba__:
Click to download the PDB-style file with coordinates for d1wba__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wba__:
- d1wba__ first appeared (with stable ids) in SCOP 1.55
- d1wba__ appears in SCOP 1.59
- d1wba__ appears in the current release, SCOPe 2.08, called d1wbaa_
View in 3D