Lineage for d1wba__ (1wba -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 60012Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 60013Family b.42.4.1: Kunitz (STI) inhibitors [50387] (5 proteins)
  6. 60038Protein Winged bean albumin 1 [50388] (1 species)
  7. 60039Species Goa bean (Psophocarpus tetragonolobus) [TaxId:3891] [50389] (1 PDB entry)
  8. 60040Domain d1wba__: 1wba - [25591]

Details for d1wba__

PDB Entry: 1wba (more details), 1.8 Å

PDB Description: winged bean albumin 1
PDB Compounds: ( :)

SCOP Domain Sequences for d1wba__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wba__ b.42.4.1 (-) Winged bean albumin 1 {Goa bean (Psophocarpus tetragonolobus)}
ddpvydaegnklvnrgkytivsfsdgagidvvatgnenpedplsivkstrnimyatsiss
edktppqprnilenmrlkinfatdphkgdvwsvvdfqpdgqqlklagrypnqvkgaftiq
kgsntprtykllfcpvgspcknigistdpegkkrlvvsyqsdplvvkfhrh

SCOP Domain Coordinates for d1wba__:

Click to download the PDB-style file with coordinates for d1wba__.
(The format of our PDB-style files is described here.)

Timeline for d1wba__: