SCOP 1.57: Domain d1iltb_: 1ilt B:

Lineage for d1iltb_ (1ilt B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.42: beta-Trefoil [50352] (5 superfamilies)

4. Superfamily b.42.1: Cytokine [50353] (2 families)

5. Family b.42.1.2: Interleukin-1 (IL-1) [50362] (3 proteins)

6. Protein Interleukin-1 receptor antagonist protein [50366] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50367] (5 PDB entries)

8. Domain d1iltb_: 1ilt B: [25555]

Details for d1iltb_

PDB Entry: 1ilt, 2 Å

PDB Description: x-ray structure of interleukin-1 receptor antagonist at 2.0 angstroms resolution

SCOP Domain Sequences for d1iltb_:

Sequence; same for both SEQRES and ATOM records:

>d1iltb_ b.42.1.2 (B:) Interleukin-1 receptor antagonist protein {Human (Homo sapiens)}
mqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflgihggkmclsc
vksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgwflctameadq
pvsltnmpdegvmvtkfyfqede

Timeline for d1iltb_:

• d1iltb_ first appeared (with stable ids) in SCOP 1.55
  
• d1iltb_ appears in SCOP 1.59
  
• d1iltb_ appears in the current release, SCOPe 2.08