Lineage for d1itba_ (1itb A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14402Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 14463Family b.42.1.2: Interleukin-1 (IL-1) [50362] (3 proteins)
  6. 14477Protein Interleukin-1beta [50363] (2 species)
  7. 14478Species Human (Homo sapiens) [TaxId:9606] [50364] (13 PDB entries)
  8. 14487Domain d1itba_: 1itb A: [25546]
    Other proteins in same PDB: d1itbb1, d1itbb2, d1itbb3

Details for d1itba_

PDB Entry: 1itb (more details), 2.5 Å

PDB Description: type-1 interleukin-1 receptor complexed with interleukin-1 beta

SCOP Domain Sequences for d1itba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itba_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens)}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdftmqfvss

SCOP Domain Coordinates for d1itba_:

Click to download the PDB-style file with coordinates for d1itba_.
(The format of our PDB-style files is described here.)

Timeline for d1itba_: