SCOP 1.59: Domain d1eysh1: 1eys H:59-259

Lineage for d1eysh1 (1eys H:59-259)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Thermochromatium tepidum [TaxId:1050] [50351] (1 PDB entry)

8. Domain d1eysh1: 1eys H:59-259 [25484]
   Other proteins in same PDB: d1eysc_, d1eysh2, d1eysl1, d1eysm1

Details for d1eysh1

PDB Entry: 1eys, 2.2 Å

PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum

SCOP Domain Sequences for d1eysh1:

Sequence; same for both SEQRES and ATOM records:

>d1eysh1 b.41.1.1 (H:59-259) Photosynthetic reaction centre {Thermochromatium tepidum}
pdlpdpktfvlphnggtvvaprveapvavnatpfspapgsplvpngdpmlsgfgpaaspd
rpkhcdltfeglpkivpmrvakefsiaegdpdprgmtvvgldgevagtvsdvwvdrsepq
irylevevaankkkvllpigfsrfdkkarkvkvdaikaahfanvptlsnpdqvtlyeedk
vcayyaggklyataeragpll

Timeline for d1eysh1:

• d1eysh1 first appeared (with stable ids) in SCOP 1.55
  
• d1eysh1 appears in SCOP 1.57
  
• d1eysh1 appears in SCOP 1.61
  
• d1eysh1 appears in the current release, SCOPe 2.08