Lineage for d1eysh1 (1eys H:59-259)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791427Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2791428Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2791429Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2791430Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2791556Species Thermochromatium tepidum [TaxId:1050] [50351] (1 PDB entry)
  8. 2791557Domain d1eysh1: 1eys H:59-259 [25484]
    Other proteins in same PDB: d1eysc_, d1eysh2, d1eysl_, d1eysm_
    complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef

Details for d1eysh1

PDB Entry: 1eys (more details), 2.2 Å

PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum
PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d1eysh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eysh1 b.41.1.1 (H:59-259) Photosynthetic reaction centre {Thermochromatium tepidum [TaxId: 1050]}
pdlpdpktfvlphnggtvvaprveapvavnatpfspapgsplvpngdpmlsgfgpaaspd
rpkhcdltfeglpkivpmrvakefsiaegdpdprgmtvvgldgevagtvsdvwvdrsepq
irylevevaankkkvllpigfsrfdkkarkvkvdaikaahfanvptlsnpdqvtlyeedk
vcayyaggklyataeragpll

SCOPe Domain Coordinates for d1eysh1:

Click to download the PDB-style file with coordinates for d1eysh1.
(The format of our PDB-style files is described here.)

Timeline for d1eysh1: