SCOPe 2.04: Domain d4rcrh1: 4rcr H:36-248

Lineage for d4rcrh1 (4rcr H:36-248)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
   Uniprot P11846

8. Domain d4rcrh1: 4rcr H:36-248 [25483]
   Other proteins in same PDB: d4rcrh2, d4rcrl_, d4rcrm_
   complexed with bcl, bog, bph, fe, u10

Details for d4rcrh1

PDB Entry: 4rcr, 2.8 Å

PDB Description: structure of the reaction center from rhodobacter sphaeroides r-26 and 2.4.1: protein-cofactor (bacteriochlorophyll, bacteriopheophytin, and carotenoid) interactions

PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d4rcrh1:

Sequence; same for both SEQRES and ATOM records:

>d4rcrh1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr

Timeline for d4rcrh1:

• d4rcrh1 first appeared (with stable ids) in SCOP 1.55
  
• d4rcrh1 appears in SCOPe 2.03
  
• d4rcrh1 appears in SCOPe 2.05
  
• d4rcrh1 appears in the current release, SCOPe 2.08