Lineage for d2rcrh1 (2rcr H:36-255)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59808Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 59809Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 59810Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 59811Protein Photosynthetic reaction centre [50348] (3 species)
  7. 59812Species Rhodobacter sphaeroides [TaxId:1063] [50350] (23 PDB entries)
  8. 59838Domain d2rcrh1: 2rcr H:36-255 [25481]
    Other proteins in same PDB: d2rcrh2, d2rcrl1, d2rcrm1

Details for d2rcrh1

PDB Entry: 2rcr (more details), 3.1 Å

PDB Description: structure of the membrane-bound protein photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d2rcrh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcrh1 b.41.1.1 (H:36-255) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaam

SCOP Domain Coordinates for d2rcrh1:

Click to download the PDB-style file with coordinates for d2rcrh1.
(The format of our PDB-style files is described here.)

Timeline for d2rcrh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rcrh2