Lineage for d1psth1 (1pst H:36-248)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298012Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 298013Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 298014Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 298015Protein Photosynthetic reaction centre [50348] (3 species)
  7. 298016Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries)
  8. 298045Domain d1psth1: 1pst H:36-248 [25480]
    Other proteins in same PDB: d1psth2, d1pstl_, d1pstm_
    complexed with bcl, bph, crt, fe, u10; mutant

Details for d1psth1

PDB Entry: 1pst (more details), 3 Å

PDB Description: crystallographic analyses of site-directed mutants of the photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d1psth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psth1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr

SCOP Domain Coordinates for d1psth1:

Click to download the PDB-style file with coordinates for d1psth1.
(The format of our PDB-style files is described here.)

Timeline for d1psth1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1psth2