Lineage for d1pssh1 (1pss H:36-248)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1542883Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1542884Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1542885Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1542886Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1542887Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
    Uniprot P11846
  8. 1542969Domain d1pssh1: 1pss H:36-248 [25479]
    Other proteins in same PDB: d1pssh2, d1pssl_, d1pssm_
    complexed with bcl, bph, crt, fe, u10; mutant

Details for d1pssh1

PDB Entry: 1pss (more details), 3 Å

PDB Description: crystallographic analyses of site-directed mutants of the photosynthetic reaction center from rhodobacter sphaeroides
PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d1pssh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pssh1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr

SCOPe Domain Coordinates for d1pssh1:

Click to download the PDB-style file with coordinates for d1pssh1.
(The format of our PDB-style files is described here.)

Timeline for d1pssh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pssh2