Class b: All beta proteins [48724] (119 folds) |
Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) |
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein) |
Protein Photosynthetic reaction centre [50348] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries) |
Domain d1pssh1: 1pss H:36-248 [25479] Other proteins in same PDB: d1pssh2, d1pssl_, d1pssm_ complexed with bcl, bph, crt, fe, u10 |
PDB Entry: 1pss (more details), 3 Å
SCOP Domain Sequences for d1pssh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pssh1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkr
Timeline for d1pssh1: