Lineage for d1e14h1 (1e14 H:36-250)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167245Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 167246Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 167247Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 167248Protein Photosynthetic reaction centre [50348] (3 species)
  7. 167249Species Rhodobacter sphaeroides [TaxId:1063] [50350] (28 PDB entries)
  8. 167271Domain d1e14h1: 1e14 H:36-250 [25478]
    Other proteins in same PDB: d1e14h2, d1e14l1, d1e14m1

Details for d1e14h1

PDB Entry: 1e14 (more details), 2.7 Å

PDB Description: photosynthetic reaction center mutant with phe m197 replaced with arg (chain m, fm197r) and gly m203 replaced with asp (chain m, gm203d)

SCOP Domain Sequences for d1e14h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e14h1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

SCOP Domain Coordinates for d1e14h1:

Click to download the PDB-style file with coordinates for d1e14h1.
(The format of our PDB-style files is described here.)

Timeline for d1e14h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e14h2