SCOPe 2.05: Domain d1dv6t1: 1dv6 T:36-256

Lineage for d1dv6t1 (1dv6 T:36-256)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
   Uniprot P11846

8. Domain d1dv6t1: 1dv6 T:36-256 [25476]
   Other proteins in same PDB: d1dv6h2, d1dv6l_, d1dv6m_, d1dv6r_, d1dv6s_, d1dv6t2
   complexed with bcl, bph, cl, fe2, lda, u10, zn

Details for d1dv6t1

PDB Entry: 1dv6, 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor zn2+

PDB Compounds: (T:) photosynthetic reaction center

SCOPe Domain Sequences for d1dv6t1:

Sequence; same for both SEQRES and ATOM records:

>d1dv6t1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

Timeline for d1dv6t1:

• d1dv6t1 first appeared (with stable ids) in SCOP 1.55
  
• d1dv6t1 appears in SCOPe 2.04
  
• d1dv6t1 appears in SCOPe 2.06
  
• d1dv6t1 appears in the current release, SCOPe 2.08