Lineage for d1dv6h1 (1dv6 H:36-256)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 229641Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 229642Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 229643Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 229644Protein Photosynthetic reaction centre [50348] (3 species)
  7. 229645Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries)
  8. 229660Domain d1dv6h1: 1dv6 H:36-256 [25475]
    Other proteins in same PDB: d1dv6h2, d1dv6l_, d1dv6m_, d1dv6r_, d1dv6s_, d1dv6t2

Details for d1dv6h1

PDB Entry: 1dv6 (more details), 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor zn2+
PDB Compounds: (H:)

SCOP Domain Sequences for d1dv6h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv6h1 b.41.1.1 (H:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

SCOP Domain Coordinates for d1dv6h1:

Click to download the PDB-style file with coordinates for d1dv6h1.
(The format of our PDB-style files is described here.)

Timeline for d1dv6h1: