SCOPe 2.04: Domain d1aigh1: 1aig H:36-258

Lineage for d1aigh1 (1aig H:36-258)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.41: PRC-barrel domain [50345] (1 superfamily)
core: barrel, partly opened; n*=5, S*=8; meander
Superfamily b.41.1: PRC-barrel domain [50346] (5 families)
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
Protein Photosynthetic reaction centre [50348] (3 species)
Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
Uniprot P11846
Domain d1aigh1: 1aig H:36-258 [25473]
Other proteins in same PDB: d1aigh2, d1aigl_, d1aigm_, d1aign_, d1aigo_, d1aigp2
complexed with bcl, bph, fe2, u10

Details for d1aigh1

PDB Entry: 1aig (more details), 2.6 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the d+qb-charge separated state

PDB Compounds: (H:) photosynthetic reaction center (h subunit)

SCOPe Domain Sequences for d1aigh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aigh1 b.41.1.1 (H:36-258) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaamlae

SCOPe Domain Coordinates for d1aigh1:

Click to download the PDB-style file with coordinates for d1aigh1.
(The format of our PDB-style files is described here.)

Timeline for d1aigh1: