Lineage for d1aigh1 (1aig H:36-258)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111007Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 111008Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 111009Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 111010Protein Photosynthetic reaction centre [50348] (3 species)
  7. 111011Species Rhodobacter sphaeroides [TaxId:1063] [50350] (23 PDB entries)
  8. 111021Domain d1aigh1: 1aig H:36-258 [25473]
    Other proteins in same PDB: d1aigh2, d1aigl1, d1aigm1, d1aign1, d1aigo1, d1aigp2

Details for d1aigh1

PDB Entry: 1aig (more details), 2.6 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the d+qb-charge separated state

SCOP Domain Sequences for d1aigh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aigh1 b.41.1.1 (H:36-258) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaamlae

SCOP Domain Coordinates for d1aigh1:

Click to download the PDB-style file with coordinates for d1aigh1.
(The format of our PDB-style files is described here.)

Timeline for d1aigh1: