SCOPe 2.04: Domain d1dv3t1: 1dv3 T:36-256

Lineage for d1dv3t1 (1dv3 T:36-256)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
   Uniprot P11846

8. Domain d1dv3t1: 1dv3 T:36-256 [25472]
   Other proteins in same PDB: d1dv3h2, d1dv3l_, d1dv3m_, d1dv3r_, d1dv3s_, d1dv3t2
   complexed with bcl, bph, cd, cl, fe2, lda, u10

Details for d1dv3t1

PDB Entry: 1dv3, 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-separated d+qaqb-state with the proton transfer inhibitor cd2+

PDB Compounds: (T:) photosynthetic reaction center reaction center

SCOPe Domain Sequences for d1dv3t1:

Sequence; same for both SEQRES and ATOM records:

>d1dv3t1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

Timeline for d1dv3t1:

• d1dv3t1 first appeared (with stable ids) in SCOP 1.55
  
• d1dv3t1 appears in SCOPe 2.03
  
• d1dv3t1 appears in SCOPe 2.05
  
• d1dv3t1 appears in the current release, SCOPe 2.08