SCOP 1.59: Domain d1dv3t1: 1dv3 T:36-256

Lineage for d1dv3t1 (1dv3 T:36-256)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (23 PDB entries)

8. Domain d1dv3t1: 1dv3 T:36-256 [25472]
   Other proteins in same PDB: d1dv3h2, d1dv3l1, d1dv3m1, d1dv3r1, d1dv3s1, d1dv3t2

Details for d1dv3t1

PDB Entry: 1dv3, 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-separated d+qaqb-state with the proton transfer inhibitor cd2+

SCOP Domain Sequences for d1dv3t1:

Sequence; same for both SEQRES and ATOM records:

>d1dv3t1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

Timeline for d1dv3t1:

• d1dv3t1 first appeared (with stable ids) in SCOP 1.55
  
• d1dv3t1 appears in SCOP 1.57
  
• d1dv3t1 appears in SCOP 1.61
  
• d1dv3t1 appears in the current release, SCOPe 2.08