Lineage for d1mpsh1 (1mps H:36-250)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 229641Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 229642Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 229643Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 229644Protein Photosynthetic reaction centre [50348] (3 species)
  7. 229645Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries)
  8. 229653Domain d1mpsh1: 1mps H:36-250 [25468]
    Other proteins in same PDB: d1mpsh2, d1mpsl_, d1mpsm_
    complexed with bcl, bph, fe2, lda, po4, spn, u10; mutant

Details for d1mpsh1

PDB Entry: 1mps (more details), 2.55 Å

PDB Description: photosynthetic reaction center mutant with phe m 197 replaced with arg and tyr m 177 replaced with phe (chain m, y177f, f197r)

SCOP Domain Sequences for d1mpsh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpsh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

SCOP Domain Coordinates for d1mpsh1:

Click to download the PDB-style file with coordinates for d1mpsh1.
(The format of our PDB-style files is described here.)

Timeline for d1mpsh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mpsh2