Lineage for d1aijt1 (1aij T:36-256)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167245Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 167246Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 167247Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 167248Protein Photosynthetic reaction centre [50348] (3 species)
  7. 167249Species Rhodobacter sphaeroides [TaxId:1063] [50350] (28 PDB entries)
  8. 167252Domain d1aijt1: 1aij T:36-256 [25467]
    Other proteins in same PDB: d1aijh2, d1aijl1, d1aijm1, d1aijr1, d1aijs1, d1aijt2

Details for d1aijt1

PDB Entry: 1aij (more details), 2.2 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state

SCOP Domain Sequences for d1aijt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aijt1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

SCOP Domain Coordinates for d1aijt1:

Click to download the PDB-style file with coordinates for d1aijt1.
(The format of our PDB-style files is described here.)

Timeline for d1aijt1: