SCOP 1.65: Domain d1aijh1: 1aij H:36-256

Lineage for d1aijh1 (1aij H:36-256)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries)

8. Domain d1aijh1: 1aij H:36-256 [25466]
   Other proteins in same PDB: d1aijh2, d1aijl_, d1aijm_, d1aijr_, d1aijs_, d1aijt2

Details for d1aijh1

PDB Entry: 1aij, 2.2 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state

SCOP Domain Sequences for d1aijh1:

Sequence; same for both SEQRES and ATOM records:

>d1aijh1 b.41.1.1 (H:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

Timeline for d1aijh1:

• d1aijh1 first appeared (with stable ids) in SCOP 1.55
  
• d1aijh1 appears in SCOP 1.63
  
• d1aijh1 appears in SCOP 1.67
  
• d1aijh1 appears in the current release, SCOPe 2.08