Lineage for d1e6dh1 (1e6d H:36-250)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59808Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 59809Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 59810Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 59811Protein Photosynthetic reaction centre [50348] (3 species)
  7. 59812Species Rhodobacter sphaeroides [TaxId:1063] [50350] (23 PDB entries)
  8. 59814Domain d1e6dh1: 1e6d H:36-250 [25465]
    Other proteins in same PDB: d1e6dh2, d1e6dl1, d1e6dm1

Details for d1e6dh1

PDB Entry: 1e6d (more details), 2.3 Å

PDB Description: photosynthetic reaction center mutant with trp m115 replaced with phe (chain m, wm115f) phe m197 replaced with arg (chain m, fm197r)

SCOP Domain Sequences for d1e6dh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6dh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

SCOP Domain Coordinates for d1e6dh1:

Click to download the PDB-style file with coordinates for d1e6dh1.
(The format of our PDB-style files is described here.)

Timeline for d1e6dh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e6dh2