Lineage for d7prch1 (7prc H:37-258)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167245Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 167246Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 167247Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 167248Protein Photosynthetic reaction centre [50348] (3 species)
  7. 167284Species Rhodopseudomonas viridis [TaxId:1079] [50349] (8 PDB entries)
  8. 167292Domain d7prch1: 7prc H:37-258 [25463]
    Other proteins in same PDB: d7prcc_, d7prch2, d7prcl1, d7prcm1

Details for d7prch1

PDB Entry: 7prc (more details), 2.65 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420315 (triazine) complex)

SCOP Domain Sequences for d7prch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7prch1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOP Domain Coordinates for d7prch1:

Click to download the PDB-style file with coordinates for d7prch1.
(The format of our PDB-style files is described here.)

Timeline for d7prch1: