Lineage for d4prch1 (4prc H:37-258)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 800670Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 800671Superfamily b.41.1: PRC-barrel domain [50346] (4 families) (S)
  5. 800672Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 800673Protein Photosynthetic reaction centre [50348] (3 species)
  7. 800722Species Rhodopseudomonas viridis [TaxId:1079] [50349] (11 PDB entries)
  8. 800729Domain d4prch1: 4prc H:37-258 [25462]
    Other proteins in same PDB: d4prcc_, d4prch2, d4prcl_, d4prcm_
    complexed with 7mq, bcb, bpb, fe2, hem, lda, ns5, sma, so4

Details for d4prch1

PDB Entry: 4prc (more details), 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (stigmatellin complex)
PDB Compounds: (H:) photosynthetic reaction center

SCOP Domain Sequences for d4prch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4prch1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOP Domain Coordinates for d4prch1:

Click to download the PDB-style file with coordinates for d4prch1.
(The format of our PDB-style files is described here.)

Timeline for d4prch1: