Lineage for d1prch1 (1prc H:37-258)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111007Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 111008Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 111009Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 111010Protein Photosynthetic reaction centre [50348] (3 species)
  7. 111040Species Rhodopseudomonas viridis [TaxId:1079] [50349] (8 PDB entries)
  8. 111044Domain d1prch1: 1prc H:37-258 [25460]
    Other proteins in same PDB: d1prcc_, d1prch2, d1prcl1, d1prcm1

Details for d1prch1

PDB Entry: 1prc (more details), 2.3 Å

PDB Description: crystallographic refinement at 2.3 angstroms resolution and refined model of the photosynthetic reaction center from rhodopseudomonas viridis

SCOP Domain Sequences for d1prch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prch1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOP Domain Coordinates for d1prch1:

Click to download the PDB-style file with coordinates for d1prch1.
(The format of our PDB-style files is described here.)

Timeline for d1prch1: