Lineage for d1dxrh1 (1dxr H:37-258)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 229641Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 229642Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 229643Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 229644Protein Photosynthetic reaction centre [50348] (3 species)
  7. 229681Species Rhodopseudomonas viridis [TaxId:1079] [50349] (8 PDB entries)
  8. 229682Domain d1dxrh1: 1dxr H:37-258 [25456]
    Other proteins in same PDB: d1dxrc_, d1dxrh2, d1dxrl_, d1dxrm_
    complexed with bcb, bpb, fe2, hec, lda, mq9, mst, ns5, so4; mutant

Details for d1dxrh1

PDB Entry: 1dxr (more details), 2 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex)

SCOP Domain Sequences for d1dxrh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxrh1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOP Domain Coordinates for d1dxrh1:

Click to download the PDB-style file with coordinates for d1dxrh1.
(The format of our PDB-style files is described here.)

Timeline for d1dxrh1: