SCOP 1.67: Domain d2eipb_: 2eip B:

Lineage for d2eipb_ (2eip B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family)

5. Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein)
   barrel, closed; n=5, S=8

6. Protein Inorganic pyrophosphatase [50326] (5 species)
   eukaryotic enzyme has additional secondary structures at both N- and C-termini

7. Species Escherichia coli [TaxId:562] [50329] (13 PDB entries)

8. Domain d2eipb_: 2eip B: [25424]

Details for d2eipb_

PDB Entry: 2eip, 2.2 Å

PDB Description: inorganic pyrophosphatase

SCOP Domain Sequences for d2eipb_:

Sequence; same for both SEQRES and ATOM records:

>d2eipb_ b.40.5.1 (B:) Inorganic pyrophosphatase {Escherichia coli}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferak

Timeline for d2eipb_:

• d2eipb_ first appeared (with stable ids) in SCOP 1.55
  
• d2eipb_ appears in SCOP 1.65
  
• d2eipb_ appears in SCOP 1.69
  
• d2eipb_ appears in the current release, SCOPe 2.08