Lineage for d4potd_ (4pot D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823225Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2823226Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 2823296Protein automated matches [191200] (13 species)
    not a true protein
  7. 2823375Species Human polyomavirus 9 [TaxId:943908] [229433] (7 PDB entries)
  8. 2823429Domain d4potd_: 4pot D: [254092]
    automated match to d4posb_
    complexed with ca, edo, ipa

Details for d4potd_

PDB Entry: 4pot (more details), 2.1 Å

PDB Description: structure of human polyomavirus 9 vp1 pentamer in complex with n- glycolylneuraminic acid containing 3'-sialyllactosamine
PDB Compounds: (D:) vp1

SCOPe Domain Sequences for d4potd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4potd_ b.121.6.1 (D:) automated matches {Human polyomavirus 9 [TaxId: 943908]}
vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys
vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt
lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw
spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg
ihtnysesqnwrglpryfnvtlrkrvvknp

SCOPe Domain Coordinates for d4potd_:

Click to download the PDB-style file with coordinates for d4potd_.
(The format of our PDB-style files is described here.)

Timeline for d4potd_: