Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein automated matches [191200] (13 species) not a true protein |
Species Human polyomavirus 9 [TaxId:943908] [229433] (7 PDB entries) |
Domain d4potd_: 4pot D: [254092] automated match to d4posb_ complexed with ca, edo, ipa |
PDB Entry: 4pot (more details), 2.1 Å
SCOPe Domain Sequences for d4potd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4potd_ b.121.6.1 (D:) automated matches {Human polyomavirus 9 [TaxId: 943908]} vevlevrtgpdaitqieaylnprmgnnnptdelygysadinvasskasdnpnattlptys vaviklpmlnedmtcdtllmweavsvktevmgisslvnlhqggkyiygsssgtipvqgtt lhmfsvggeplelqglvasstttyptdmvtiknmkpvnqaldpnakalldkdgkypvevw spdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsavdivg ihtnysesqnwrglpryfnvtlrkrvvknp
Timeline for d4potd_: