Lineage for d4p31b_ (4p31 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849810Species Escherichia coli K-12 [TaxId:83333] [231728] (5 PDB entries)
  8. 1849816Domain d4p31b_: 4p31 B: [254068]
    automated match to d4p32a_
    complexed with adp, mg

Details for d4p31b_

PDB Entry: 4p31 (more details), 2.05 Å

PDB Description: crystal structure of a selenomethionine derivative of e. coli lptb in complex with adp-magensium
PDB Compounds: (B:) Lipopolysaccharide export system ATP-binding protein LptB

SCOPe Domain Sequences for d4p31b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p31b_ c.37.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii
iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel
meefhiehlrdsmgqslsggerrrveiaralaanpkfilldepfagvdpisvidikriie
hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqdehvk

SCOPe Domain Coordinates for d4p31b_:

Click to download the PDB-style file with coordinates for d4p31b_.
(The format of our PDB-style files is described here.)

Timeline for d4p31b_: